PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K00251.1.p
Common NameEUGRSUZ_K00251, LOC104424411
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 296aa    MW: 33315.8 Da    PI: 6.8505
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K00251.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.2e-131562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEd++l +++  +G g W++++   g+ R +k+c++rw +yl
  Eucgr.K00251.1.p 15 KGLWSPEEDQRLRNYILNHGHGYWSSVPINTGLQRNGKSCRLRWINYL 62
                      678*******************************************97 PP

2Myb_DNA-binding55.41.4e-1768113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg +T eE+e+++ ++++ G++ W+ Ia++++ gRt++++k++w++yl
  Eucgr.K00251.1.p  68 RGMFTLEEEEIILSLHRLIGNK-WSQIAKHLP-GRTDNEIKNHWHSYL 113
                       789*******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.3751062IPR017930Myb domain
SuperFamilySSF466894.03E-2912109IPR009057Homeodomain-like
SMARTSM007177.9E-81464IPR001005SANT/Myb domain
PfamPF002496.1E-121562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-211669IPR009057Homeodomain-like
CDDcd001672.08E-71862No hitNo description
PROSITE profilePS5129427.27963117IPR017930Myb domain
SMARTSM007174.2E-1567115IPR001005SANT/Myb domain
PfamPF002496.0E-1668113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2670117IPR009057Homeodomain-like
CDDcd001673.95E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MALKSSERPK PKHRKGLWSP EEDQRLRNYI LNHGHGYWSS VPINTGLQRN GKSCRLRWIN  60
YLRPGLKRGM FTLEEEEIIL SLHRLIGNKW SQIAKHLPGR TDNEIKNHWH SYLKKKVANK  120
TESSSSSEAR HNAQSQCTNS DNVESSPSPD QIPTNQNASV HAPSQEQKEK MSLDFPNGGP  180
RSCLPNIFFA EWLNQADQGY NVPTYGDAFD YRSNIQDSLV HDWCTSDFGN SNGGEYVGNE  240
LSKGSASASV SDMYSSRLKS EMDQVSGGGF YLDYFSGDDI CSQFDMGSDV NMMYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251111723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K00251.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035126.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K42e-56LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A058ZYA50.0A0A058ZYA5_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s13190.12e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.16e-60myb domain protein 19